PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa013206
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family G2-like
Protein Properties Length: 414aa    MW: 45136.3 Da    PI: 7.999
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Lsa#S58688359PU_refUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like106.71.3e-3346100155
    G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                kprlrWt eLHerFv+av+qLGG++kAtPkti+++m+vkgLtl+h+kSHLQk+Rl
  Lsa013206  46 KPRLRWTVELHERFVDAVAQLGGPDKATPKTIMRVMGVKGLTLYHLKSHLQKFRL 100
                79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.80143103IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.0E-3243101IPR009057Homeodomain-like
SuperFamilySSF466892.15E-1645101IPR009057Homeodomain-like
TIGRFAMsTIGR015571.6E-2346101IPR006447Myb domain, plants
PfamPF002493.3E-84898IPR001005SANT/Myb domain
PfamPF143791.0E-21143182IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 414 aa     Download sequence    Send to blast
MNSLHHNHHQ HHERSNMCGV GANNHNTAGA GTIQGDSGLV LTTDPKPRLR WTVELHERFV  60
DAVAQLGGPD KATPKTIMRV MGVKGLTLYH LKSHLQKFRL GKQPHKEFND HSIKDSERAS  120
ALELQRNSTA SSSGMMGRSM NEMQIEVQRR LHEQLEVQRH LQLRIEAQGK YMQTILEKAC  180
QTLAGDQSMA TAAGYNNGNK VVGGMGMNMN MSMSMNISAS SSSTSHLDQA AAGHRGGVML  240
LPGDHVPSAI KDFGSLNFPS FQDLNLYGTS QSPSPPAVAA AGTAAARKSP LVWSDDELHL  300
QDDHHRQTEH HHIGVLSSNT SEAGDGCDLD STIPSHIYET KPLTLASSHN IDHHHHHHLG  360
LGSVDHQKKM DRTSPRRPPL SSNSSMDNMR ATLSTATNNS TSNMSPQGRS SSFS
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007211463.11e-114hypothetical protein PRUPE_ppa007417mg
SwissprotQ9SAK57e-96APL_ARATH; Myb family transcription factor APL
TrEMBLA0A118K1530.0A0A118K153_CYNCS; Homeodomain-like protein (Fragment)
STRINGGLYMA15G29620.11e-108(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G79430.21e-95G2-like family protein